PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g05990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 169aa    MW: 19436.9 Da    PI: 8.3284
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g05990.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.5e-201764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+++++ +G ++WktIa + g++R++k+c++rw++yl
   Vang11g05990.1 17 RGSWTPEEDRKLAQCIQFHGAKRWKTIAVKSGLNRCGKSCRLRWLNYL 64
                     89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.0141268IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-211467IPR009057Homeodomain-like
SMARTSM007175.0E-161666IPR001005SANT/Myb domain
PfamPF002491.1E-171764IPR001005SANT/Myb domain
SuperFamilySSF466893.06E-221895IPR009057Homeodomain-like
CDDcd001674.58E-121964No hitNo description
PROSITE profilePS500904.41465111IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.8E-86895IPR009057Homeodomain-like
SMARTSM007173.569111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MAPRINDATP NRSPMNRGSW TPEEDRKLAQ CIQFHGAKRW KTIAVKSGLN RCGKSCRLRW  60
LNYLRPNIKR GNISDEEEDL ILRLHRLLGN RFLIIKHFYT IARKAGYNKN PGDNLALSEN  120
EVATNEVGNL DVSFNIDEFF NFSEESCGLD WLNKYLELDH IPQTTENS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-17159525104MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150345e-99AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508468.11e-101PREDICTED: transcription factor MYB114-like
TrEMBLA0A0S3R5G71e-105A0A0S3R5G7_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TPS71e-105A0A0L9TPS7_PHAAN; Uncharacterized protein
STRINGGLYMA05G04900.11e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-32myb domain protein 66